PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf05060g05007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 464aa    MW: 50965.1 Da    PI: 6.688
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf05060g05007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1239.7e-39113171260
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                               ++k+l+cprC+s++tkfCy+nny++sqPr+fCk+C+ryWt+GG++rnvPvG+grrk+k+
  Niben101Scf05060g05007.1 113 PDKILPCPRCNSMETKFCYFNNYNVSQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKHKN 171
                               7899****************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-29110170IPR003851Zinc finger, Dof-type
PfamPF027018.2E-32115171IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.584117171IPR003851Zinc finger, Dof-type
PROSITE patternPS013610119155IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MAEAIANKDP AIKLFGRTIQ LPDFPALSPA DTGDYSSSSR VAELEHKGQC DDCKDENEHL  60
IAKELQDRNP IPEKSDIIEE SPSYNDCSIA KTSKSEEEQA ETSNSQEKIL KKPDKILPCP  120
RCNSMETKFC YFNNYNVSQP RHFCKNCQRY WTAGGTMRNV PVGAGRRKHK NPVLHYHHIS  180
VSETLTDLSN GIQPPPLKLN GTILPFDTDK PLRESMGSVL NIADKTMQDC SGNGFHRYKE  240
LGIQAGDNGD DRSDGSSVTA LSSKDSDNGS PDMPRQNCDS FSPHLPCFTG APWPYPWSSV  300
HLSNAVPPPG YYLPSFPMPF VPAYWGCAIP GSCNVPWMSP PTASQNQMPP TSSPNSPTLG  360
KHPRDEIILK SMGSEEEPRK ESNPPEKCLW FPKTLRIGEP GEAAKSSIWA TLGIKHDGVN  420
SVSGGSFKAF LPKSDERNHV SGNSSVLKAN PAAMSRSLNF KENS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009792864.10.0PREDICTED: cyclic dof factor 3-like
TrEMBLM0ZLI40.0M0ZLI4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000033590.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-90cycling DOF factor 2